Bioactive Small Molecules
Selleck Chemical LLC Angoroside C S9407-5MG
Angoroside C an important phenylpropanoid glycoside of the traditional Chinese medicine Scrophulariae Radix possesses the effects of preventing ventricular remodeling reducing pulmonary oedema and reducing blood pressure as well as having the properties of anti-platelet aggregation hepatoprotection and anti-nephritis etc
Medchemexpress LLC Cycrimine | 77-39-4 | 99.9% | 10 MG
Cycrimine is an orally active muscarinic cholinergic receptor (mAChR) M1 antagonist used as a research reagent. It reduces acetylcholine levels in Parkinson's disease models, shows antispasmodic activity, and is used in behavioral and neurological disorder studies.
- Orally active mAChR M1 antagonist used in in vivo and in vitro research.
- Reduces acetylcholine levels in Parkinson's disease models.
- Shows antispasmodic activity relevant to behavioral and neurological studies.
- Available in small mg-scale quantities suitable for laboratory experiments.
- Molecular formula C19H29NO and molecular weight 287.44 g·mol⁻¹.
Cayman Chemical ANTIBODY BLU-285 25mg
A dual inhibitor of KIT and PDGFRα mutant kinases (IC50s = 0.27 and 0.24 nM for KITD816V and PDGFRαD842V, respectively); >150-fold selective for KITD816V and PDGFRαD842V over a kinase panel at a concentration of 3 μM; has activity against a panel of KIT and PDGFRα loop mutants identified in patients with GISTs (IC50s = D814Y mastocytoma allograft mouse model and a GIST patient-derived mouse xenograft model in a dose-dependent manner when administered at doses ranging from 0.3-30 mg/kg
Cayman Chemical ANTIBODY on-4059 25mg
A BTK inhibitor (IC50 = 2.2 nM); selective for BTK over LCK, LYN, and Fyn at 1 µM; inhibits B cell proliferation and activation in vitro and reduces tumor growth in a TMD8 mouse xenograft model
Medchemexpress LLC FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | 98.01% | 3692.15 | 5 MG
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative that functions as a pure GLP-1 receptor agonist. These derivatives are structurally related to Exendin-4 and may also act as dual GLP-1/glucagon receptor agonists. They are of interest for medical use, particularly in the treatment of metabolic syndrome disorders such as diabetes and obesity, and for reducing excessive food intake.
- Acts as a pure GLP-1 receptor agonist
- Structurally derived from Exendin-4
- Potential as a dual GLP-1/glucagon receptor agonist
- May be used to treat metabolic syndrome disorders, including diabetes and obesity
- Can help reduce excess food intake
- Shows reduced activity on the GIP receptor to mitigate hypoglycemia risk
![Medchemexpress LLC N-[4-(3-amino-hexahydro-dioxoimidazo-pteridin-yl)benzoyl]-L-glutamic acid | 10538-99-5 | MFCD29920315 | 98.0% | 471.42 g·mol⁻¹ | C20H21N7O7 | 1 ML](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000248911.png-250.jpg)
Medchemexpress LLC N-[4-(3-amino-hexahydro-dioxoimidazo-pteridin-yl)benzoyl]-L-glutamic acid | 10538-99-5 | MFCD29920315 | 98.0% | 471.42 g·mol⁻¹ | C20H21N7O7 | 1 ML
LY 345899 is a folate-analog inhibitor of methylenetetrahydrofolate dehydrogenase enzymes (MTHFD1 and MTHFD2), supplied as a high-purity research compound. It is provided as a solid and as a 10 mM solution in DMSO (1 mL), and is used for biochemical and cellular studies of one-carbon metabolism and oncology research.
- Inhibits methylenetetrahydrofolate dehydrogenase enzymes (MTHFD1 and MTHFD2).
- Offered at high purity (≥98.0%).
- Available as a 10 mM solution in DMSO (1 mL) and as solids in multiple mg sizes.
- Stable with recommended storage: powder at -20°C, in solvent at -80°C for long-term storage.
- Suitable for biochemical and cellular research into one-carbon metabolism and oncology.
Cayman Chemical ANTIBODY namorelIn 25mg
A small molecule agonist of GHS-R1a (Ki = 0.7 nM); induces calcium mobilization in CHO cells expressing rat GHS-R1a in a concentration-dependent manner and GH release from rat pituitary cells (EC50 = 1.5 nM); stimulates GH release in sham and vagotomized rats; increases food intake in rats
Selleck Chemical LLC Raddeanin A S9262-5MG
Raddeanin A (Raddeanin R3 NSC382873) a triterpenoid saponin from Anemone raddeana Regel displays moderate inhibitory activity against histone deacetylases (HDACs) and has high antiangiogenic potency antitumor activity
Medchemexpress LLC CM-338 1mg | 1mg
CM-338 is a human monoclonal antibody (mAb) targeting MASP2 CM-338 can be used in IgA nephropathy research
Cayman Chemical BradykInIn Fragment1-5tr 5mg
A metabolite of bradykinin; increases NO production in neonatal rat cardiomyocytes at 100 nM; inhibits α-thrombin-induced platelet aggregation of washed isolated platelets (IC50 = 0.5 mM); prevents decreases in mean arterial blood pressure and heart rate and increases survival in a rat model of LPS-induced septicemia
Medchemexpress LLC Pneumocandin B0 | 135575-42-7 | 96.5% | 1065.21 | 100 MG
Pneumocandin B0 is the precursor of the synthetic antifungal agent Cancidas. It can be isolated from the fungus Glarea lozoyensis and serves as an intermediate for the synthesis of the echinocandin antifungal agent, which inhibits the synthesis of β-(1,3)-D-glucan in the fungal cell wall. It shows inhibitory activity against invasive aspergillosis and Candida infections.
- Precursor of synthetic antifungal agent
- Isolated from Glarea lozoyensis fungus
- Intermediate for antifungal agent synthesis
- Inhibits β-(1,3)-D-glucan synthesis in fungal cell wall
- Exhibits inhibitory activity against invasive aspergillosis
- Exhibits inhibitory activity against Candida infections
eMolecules 1415379-56-4 | Medchem Express | T807 | 5mg | 446256546 | HY-101184 | MFCD29767874 | 263.275 | C16H10FN3
Medchem Express | QC6352 | 1mg | 446258515 | HY-104048 | 1851373-36-8 | 387.483 | C24H25N3O2
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
Medchemexpress LLC SSTC3 | 1242422-09-8 | 99.4% | 1 ML
SSTC3 is a small-molecule activator of casein kinase 1α (CK1α) that inhibits WNT signaling with nanomolar potency. It is supplied as a high-purity solid and as a 10 mM solution in DMSO for research use.
- Activates CK1α with Kd ≈ 32 nM and inhibits WNT signaling (EC50 ≈ 30 nM).
- High reported purity (≈99.4%), suitable for biochemical studies.
- Supplied as 10 mM in DMSO (1 mL) or as solid quantities for in vitro research.
- Soluble in DMSO (125 mg/mL) and compatible with common in vivo formulations at ≥2.08 mg/mL.
- Stable when stored as powder at -20°C (up to 3 years) and in solution at -80°C (up to 2 years).
Selleck Chemical LLC Ornidazole E6017-100MG
Ornidazole (Levo-) (Levornidazole (S)-Ornidazole) the levo-isomer of ornidazole is a third-generation nitroimidazole derivative It exhibits antiprotozoal and antibacterial properties against anaerobic bacteria